(data stored in ACNUC7421 zone)

EMBL: CR954246.PE484

CR954246.PE484       Location/Qualifiers
FT   CDS             521804..523981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0508"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85598"
FT                   /db_xref="GOA:Q3IG83"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG83"
FT                   /protein_id="CAI85598.1"
FT                   /translation="MSTLKAKRALFSYPKYWAECYGTAPFLPTTREEMDALGWDSCDII
FT                   IISGDAYVDHPSFGMAVIGRVLEAQGFRVGIIAQPEWDSKEAFMALGKPNLFFGVTAGN
FT                   MDSMINRYTAEKRMRHDDAYTPDNIGGKRPDRAVIIYSQRCREAYKDVPLILGGIEASL
FT                   RRVAHYDYWQEKVRRSVLFDAKADILIYGNAERPLVEVAHRIAAGESTDTIQDVRGTAV
FT                   IRKEPLPGWRGSDSTAIDKIGKIDPIPNPYGADDVGCSKSEFKQAGIDLKAEAAKVITI
FT                   QPARPKPWEKTYVKLPAFEQVSVNKPLYAHASRIVHQETNPGCARAIFQRHGDRSIWVN
FT                   PPAYPLETHEMDAVFGLPYQRIPHPSYGDAKIPAYDMIKTSVNIMRGCFGGCSFCSITE
FT                   HEGRIIQSRSQESIIEEIEQIRDKVPGFTGVISDLGGPTANMYKLGCTSKKAESTCRRL
FT                   SCVYPEICKHMDTDHTPTIELYKKAREVKGIKKILIASGVRYDLAVQDPRYVKELVTHH
FT                   VGGYLKIAPEHTEDGPLSKMMKPGMGAYDQFKALFDKYSKEAGKKQYLIPYFISAHPGT
FT                   KDEDMVNMALWLKSNDFKLDQVQNFYPSPMANATTIYHTEMNSLRNIKNNTEVVPVPKG
FT                   ARQRRLHKAILRYHDPAGWPMIREALRKMGKANLIGKAPNCLVPEEGRDERAAKGSSRG
FT                   GRPALTRHTGFSQFHKANTKPKVASNRQRAK"
     MSTLKAKRAL FSYPKYWAEC YGTAPFLPTT REEMDALGWD SCDIIIISGD AYVDHPSFGM        60
     AVIGRVLEAQ GFRVGIIAQP EWDSKEAFMA LGKPNLFFGV TAGNMDSMIN RYTAEKRMRH       120
     DDAYTPDNIG GKRPDRAVII YSQRCREAYK DVPLILGGIE ASLRRVAHYD YWQEKVRRSV       180
     LFDAKADILI YGNAERPLVE VAHRIAAGES TDTIQDVRGT AVIRKEPLPG WRGSDSTAID       240
     KIGKIDPIPN PYGADDVGCS KSEFKQAGID LKAEAAKVIT IQPARPKPWE KTYVKLPAFE       300
     QVSVNKPLYA HASRIVHQET NPGCARAIFQ RHGDRSIWVN PPAYPLETHE MDAVFGLPYQ       360
     RIPHPSYGDA KIPAYDMIKT SVNIMRGCFG GCSFCSITEH EGRIIQSRSQ ESIIEEIEQI       420
     RDKVPGFTGV ISDLGGPTAN MYKLGCTSKK AESTCRRLSC VYPEICKHMD TDHTPTIELY       480
     KKAREVKGIK KILIASGVRY DLAVQDPRYV KELVTHHVGG YLKIAPEHTE DGPLSKMMKP       540
     GMGAYDQFKA LFDKYSKEAG KKQYLIPYFI SAHPGTKDED MVNMALWLKS NDFKLDQVQN       600
     FYPSPMANAT TIYHTEMNSL RNIKNNTEVV PVPKGARQRR LHKAILRYHD PAGWPMIREA       660
     LRKMGKANLI GKAPNCLVPE EGRDERAAKG SSRGGRPALT RHTGFSQFHK ANTKPKVASN       720
     RQRAK                                                                   725
//

If you have problems or comments...

PBIL Back to PBIL home page