(data stored in ACNUC7421 zone)

EMBL: CR954246.PE485

CR954246.PE485       Location/Qualifiers
FT   CDS             complement(524121..524441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0509"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85599"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG82"
FT                   /protein_id="CAI85599.1"
FT                   /translation="MSRLKLTIALVSFCCLFLLACATKVSATTNMVVVSSLATQPNLQQ
FT                   SITHTLRTNPNLALSDIRVQVKNGEVDLYGKAQTGFERALAQKFLENMDGVKIIRNKID
FT                   II"
     MSRLKLTIAL VSFCCLFLLA CATKVSATTN MVVVSSLATQ PNLQQSITHT LRTNPNLALS        60
     DIRVQVKNGE VDLYGKAQTG FERALAQKFL ENMDGVKIIR NKIDII                      106
//

If you have problems or comments...

PBIL Back to PBIL home page