(data stored in ACNUC7421 zone)

EMBL: CR954246.PE487

CR954246.PE487       Location/Qualifiers
FT   CDS             525998..526696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0511"
FT                   /product="conserved protein of unknown function ; putative
FT                   SAM-dependent methyltransferase(yfiC)"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85601"
FT                   /db_xref="GOA:Q3IG80"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR022882"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IG80"
FT                   /protein_id="CAI85601.1"
FT                   /translation="MSGFAFKQFKVAHEQCAMKVSTDGILLGAWANLSNANSLLDIGTG
FT                   TGLLALMCKQRSPQLTITAVEVDKNAYQQALQNIAASPWPNIEVHQQSIQTFNSAQPFD
FT                   VVIANPPYFNHSLKGNNKARNIARHTDGLSFAELISAFKKLSHAGSTFSLILPTTEVAV
FT                   FIELATQNGLFLNTHCQVKATPNKAISRSLMTFSYINQSIVESALCIKDNENNYSEDYI
FT                   ALCKAFYLKM"
     MSGFAFKQFK VAHEQCAMKV STDGILLGAW ANLSNANSLL DIGTGTGLLA LMCKQRSPQL        60
     TITAVEVDKN AYQQALQNIA ASPWPNIEVH QQSIQTFNSA QPFDVVIANP PYFNHSLKGN       120
     NKARNIARHT DGLSFAELIS AFKKLSHAGS TFSLILPTTE VAVFIELATQ NGLFLNTHCQ       180
     VKATPNKAIS RSLMTFSYIN QSIVESALCI KDNENNYSED YIALCKAFYL KM               232
//

If you have problems or comments...

PBIL Back to PBIL home page