(data stored in ACNUC7421 zone)

EMBL: CR954246.PE488

CR954246.PE488       Location/Qualifiers
FT   CDS             526749..527195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0512"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85602"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG79"
FT                   /protein_id="CAI85602.1"
FT                   /translation="MKKRTKSVLLSALAATFFTTQSVLASMTPVGLWKTIDEDTNEAKS
FT                   YVRIVENNGVLSGTIETLLNKDKQNAVCSQCSGDKKDQPILGMTIIDNVIDSGDGSWED
FT                   GQILDPNNGKSYTVRLTTQDAGEKLEVRGYIGFFYRNQYWLRVE"
     MKKRTKSVLL SALAATFFTT QSVLASMTPV GLWKTIDEDT NEAKSYVRIV ENNGVLSGTI        60
     ETLLNKDKQN AVCSQCSGDK KDQPILGMTI IDNVIDSGDG SWEDGQILDP NNGKSYTVRL       120
     TTQDAGEKLE VRGYIGFFYR NQYWLRVE                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page