(data stored in ACNUC7421 zone)

EMBL: CR954246.PE49

CR954246.PE49        Location/Qualifiers
FT   CDS             complement(55661..56116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0053"
FT                   /product="putative transcriptional regulator (LRP/AsnC
FT                   family)"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 11230123, 12458218; Product type r :
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85163"
FT                   /db_xref="GOA:Q3IF05"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF05"
FT                   /protein_id="CAI85163.1"
FT                   /translation="MLDKKDQQLLIALQANARMSVADLASHISLSDTPCLRRIKKLEQA
FT                   SIITGYHAAINPKALKLNVLVYAFVRLNQNSASAARQFEQHVEKLTHVLECSVISGSYD
FT                   YLLKIIAHDLESYEQFVKHQLGSLSCIANIESTVVLKQSFSKKQLPL"
     MLDKKDQQLL IALQANARMS VADLASHISL SDTPCLRRIK KLEQASIITG YHAAINPKAL        60
     KLNVLVYAFV RLNQNSASAA RQFEQHVEKL THVLECSVIS GSYDYLLKII AHDLESYEQF       120
     VKHQLGSLSC IANIESTVVL KQSFSKKQLP L                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page