(data stored in ACNUC7421 zone)

EMBL: CR954246.PE495

CR954246.PE495       Location/Qualifiers
FT   CDS             534413..534592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0519"
FT                   /product="putative orphan protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85609"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD6"
FT                   /protein_id="CAI85609.1"
FT                   /translation="MKNKCIENPINNCETEDARQAFYRACIAEFQKLGYQEQYLAELND
FT                   DLVPVLGVNPPEKS"
     MKNKCIENPI NNCETEDARQ AFYRACIAEF QKLGYQEQYL AELNDDLVPV LGVNPPEKS         59
//

If you have problems or comments...

PBIL Back to PBIL home page