(data stored in ACNUC7421 zone)

EMBL: CR954246.PE496

CR954246.PE496       Location/Qualifiers
FT   CDS             535840..537015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0521"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85610"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD5"
FT                   /protein_id="CAI85610.1"
FT                   /translation="MFKTLFITLFFIFSATLILSVQADEAKGSIVVGAQQYTKYLPQLK
FT                   NKRVGLVVNQTSTVEKIHLVDSLREKNVNITKIFAPEHGFRGDHDAGAHVKNAVDSKTG
FT                   IPLISIYGNNKKPSAEVLADVDVIIFDIQDVGVRFYTYISSMHYMMEAAAEQEVEFIVL
FT                   DRPNPNIAYVDGPILEPQFKSFVGMHPIPVVHGMTVGELANMIKGEGWINQAAVLELNV
FT                   IPVSGYTRATSYSLPIKPSPNLPNDTAISLYPSLCFFEATPISIGRGTDFAFQVIGYSP
FT                   IALGEFSFTPRAIKGAALNPKFKNQAVQGLDLRQATTKGLDLSYLISAYKQLNNNDITF
FT                   FERADFMDKLAGTDKLRLAIEAGQSAQQIKQTWQAALMQFKQQRAPYLLYE"
     MFKTLFITLF FIFSATLILS VQADEAKGSI VVGAQQYTKY LPQLKNKRVG LVVNQTSTVE        60
     KIHLVDSLRE KNVNITKIFA PEHGFRGDHD AGAHVKNAVD SKTGIPLISI YGNNKKPSAE       120
     VLADVDVIIF DIQDVGVRFY TYISSMHYMM EAAAEQEVEF IVLDRPNPNI AYVDGPILEP       180
     QFKSFVGMHP IPVVHGMTVG ELANMIKGEG WINQAAVLEL NVIPVSGYTR ATSYSLPIKP       240
     SPNLPNDTAI SLYPSLCFFE ATPISIGRGT DFAFQVIGYS PIALGEFSFT PRAIKGAALN       300
     PKFKNQAVQG LDLRQATTKG LDLSYLISAY KQLNNNDITF FERADFMDKL AGTDKLRLAI       360
     EAGQSAQQIK QTWQAALMQF KQQRAPYLLY E                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page