(data stored in ACNUC7421 zone)

EMBL: CR954246.PE497

CR954246.PE497       Location/Qualifiers
FT   CDS             537026..538687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0522"
FT                   /product="conserved protein of unknown function; putative
FT                   peptidase with beta-lactamase domain (partial match)"
FT                   /function="2.1 : Metabolism of carbohydrates and related
FT                   molecules"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85611"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD4"
FT                   /protein_id="CAI85611.1"
FT                   /translation="MYLYLKNKNYYSIKKLLIVALSFMLGACSSSVEPLEPKALLTQSK
FT                   LVELPNAQVIVTFPEPNPSSREYVNNRGTFKAYKGHGQLLIQNHSAKSADIYINNQLLN
FT                   IKQLLGANTVYQYSLAKLTHNGVNTFKVANIQPAGASLTLRFAFPTLNKASHQQANFSE
FT                   VDALIERDIKAGFPGAVLAVVKNGELIKLTAYGDAKQYQQNDLMLLRPEPMQTDTLFDL
FT                   ASNTKIFATNFALMKLVSEGLLNINKPVQLYLPEYQGDGREQRRVKDLLTHSAGYPPVF
FT                   DFHRKDSSNGDVFYSQNSHTTKKLLLTSVPLSEKSLGQHVYSDIDYMILGVLVERITGL
FT                   SLDDYLEQQVYAPLKLHNTVFNPLKKGFNAQQFAATELGGNTRDGRIKFDNIRTHVLQG
FT                   QVHDERAYYSLGGVAGHAGLFSNAPDLAILCQLLLNNGGYGDKQLFSASALAQFLTPQS
FT                   SDETYGLGFRLAGNNQARRWHFGPYASAQAYGHTGWTGTVTVIDPVYDLAIILLTNARH
FT                   TPITGSQKSYQFSGKNYETAQYGSVVSLIYEALLNQ"
     MYLYLKNKNY YSIKKLLIVA LSFMLGACSS SVEPLEPKAL LTQSKLVELP NAQVIVTFPE        60
     PNPSSREYVN NRGTFKAYKG HGQLLIQNHS AKSADIYINN QLLNIKQLLG ANTVYQYSLA       120
     KLTHNGVNTF KVANIQPAGA SLTLRFAFPT LNKASHQQAN FSEVDALIER DIKAGFPGAV       180
     LAVVKNGELI KLTAYGDAKQ YQQNDLMLLR PEPMQTDTLF DLASNTKIFA TNFALMKLVS       240
     EGLLNINKPV QLYLPEYQGD GREQRRVKDL LTHSAGYPPV FDFHRKDSSN GDVFYSQNSH       300
     TTKKLLLTSV PLSEKSLGQH VYSDIDYMIL GVLVERITGL SLDDYLEQQV YAPLKLHNTV       360
     FNPLKKGFNA QQFAATELGG NTRDGRIKFD NIRTHVLQGQ VHDERAYYSL GGVAGHAGLF       420
     SNAPDLAILC QLLLNNGGYG DKQLFSASAL AQFLTPQSSD ETYGLGFRLA GNNQARRWHF       480
     GPYASAQAYG HTGWTGTVTV IDPVYDLAII LLTNARHTPI TGSQKSYQFS GKNYETAQYG       540
     SVVSLIYEAL LNQ                                                          553
//

If you have problems or comments...

PBIL Back to PBIL home page