(data stored in ACNUC7421 zone)

EMBL: CR954246.PE498

CR954246.PE498       Location/Qualifiers
FT   CDS             538892..540199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0523"
FT                   /product="putative Na+/H+ antiporter family"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85612"
FT                   /db_xref="GOA:Q3ILD3"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD3"
FT                   /protein_id="CAI85612.1"
FT                   /translation="MALLLAVASSEFLLALQGEGSSVFNTFLNTIERIVSVASSPGNTR
FT                   ILIFSILIGALLAYIRESGGVAATVNMLMNKGIAKSKRQVGFLTMFTGIAVFIESNLSV
FT                   LTAGILSRGLFDKFKMSRARLAYIIDSTSAPVCILILLNGWGAFVLGLLSNYELGESAV
FT                   SVLWGSVGYNFYAIITLVIVFYTIAFDKVHGPMKQAEQKLELQTTDLKEEVKGSKARFM
FT                   LVPLITLIVSMVGFMFYTGNGVLAEGSGSKSVLYATVLAIVVAYFLMLASRQFSHHKLV
FT                   ETGFKGMGELLPLVGIVLLSLTLGASLKELGTGVFVASLVGDYLPIYLVVPALFLTGAV
FT                   MSFTTGTSWGTFAILIPIGVPLIQALGLPPSLVLGAILGGGIFGDHCSPISDTSAVSAI
FT                   ASGCDLLTHVKTQLPYALFAGGLTLIAYLVTSIIVL"
     MALLLAVASS EFLLALQGEG SSVFNTFLNT IERIVSVASS PGNTRILIFS ILIGALLAYI        60
     RESGGVAATV NMLMNKGIAK SKRQVGFLTM FTGIAVFIES NLSVLTAGIL SRGLFDKFKM       120
     SRARLAYIID STSAPVCILI LLNGWGAFVL GLLSNYELGE SAVSVLWGSV GYNFYAIITL       180
     VIVFYTIAFD KVHGPMKQAE QKLELQTTDL KEEVKGSKAR FMLVPLITLI VSMVGFMFYT       240
     GNGVLAEGSG SKSVLYATVL AIVVAYFLML ASRQFSHHKL VETGFKGMGE LLPLVGIVLL       300
     SLTLGASLKE LGTGVFVASL VGDYLPIYLV VPALFLTGAV MSFTTGTSWG TFAILIPIGV       360
     PLIQALGLPP SLVLGAILGG GIFGDHCSPI SDTSAVSAIA SGCDLLTHVK TQLPYALFAG       420
     GLTLIAYLVT SIIVL                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page