(data stored in ACNUC7421 zone)

EMBL: CR954246.PE499

CR954246.PE499       Location/Qualifiers
FT   CDS             complement(540313..541461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0524"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85613"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ05"
FT                   /protein_id="CAI85613.1"
FT                   /translation="MLKLLFASSLIFSSCSVLSKNLTTEEQRIEAATHAMPQVLMAFAD
FT                   EVNQFEQQWKSLNNFRHATDLIADYSSQLWLNAKQRIVTTKNYDDRELYWARLLSSKII
FT                   RSVKPKFILSVAEQNNLLTQLEKGSRGHNDLSFTKGSTKKIILTGFDPFLLDKNINQSN
FT                   PSGVAALLLDGQVINYQGISAEINTVMVPVRYADFDQGIIEALLAPYYALNNVDMIVTV
FT                   SMGRKDFDLERFPGKRRSVTAPDNANIIFGGTQTAPLLPSLNNQPLPGNEFVQFSLPVA
FT                   NMQQAQGPYKVIDNHKITTLEKTYEPATLAELQNSIAVNGSGGGYLSNEISYRSIRLRN
FT                   QLNSTIPTGHIHTPRIQQFEPKTEAKIVKQITAMLEHSLNAL"
     MLKLLFASSL IFSSCSVLSK NLTTEEQRIE AATHAMPQVL MAFADEVNQF EQQWKSLNNF        60
     RHATDLIADY SSQLWLNAKQ RIVTTKNYDD RELYWARLLS SKIIRSVKPK FILSVAEQNN       120
     LLTQLEKGSR GHNDLSFTKG STKKIILTGF DPFLLDKNIN QSNPSGVAAL LLDGQVINYQ       180
     GISAEINTVM VPVRYADFDQ GIIEALLAPY YALNNVDMIV TVSMGRKDFD LERFPGKRRS       240
     VTAPDNANII FGGTQTAPLL PSLNNQPLPG NEFVQFSLPV ANMQQAQGPY KVIDNHKITT       300
     LEKTYEPATL AELQNSIAVN GSGGGYLSNE ISYRSIRLRN QLNSTIPTGH IHTPRIQQFE       360
     PKTEAKIVKQ ITAMLEHSLN AL                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page