(data stored in ACNUC7421 zone)

EMBL: CR954246.PE50

CR954246.PE50        Location/Qualifiers
FT   CDS             56254..57423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0054"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85164"
FT                   /db_xref="GOA:Q3IDE5"
FT                   /db_xref="InterPro:IPR015029"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE5"
FT                   /protein_id="CAI85164.1"
FT                   /translation="MSTHTAIFDRWIRSAFPQINSELEQLYWQQDDKANVEGLGEPLKQ
FT                   QLKDEGNALISNLLAEGNTDEGFDSAFDLLGNVGLFMAACRRHEITEPSRETTSPLVEA
FT                   SALAMHIGASIGVTPRFATAHLTTHNKALNGTYKRFTNLPDEKLFIDYNTQGILAYKRA
FT                   SDALLKILPLGISHPTCAELLKVAKQALIDVIESNNALYTQLDTERFFNCVRPYYKPHR
FT                   VGNEIYRGANAGDFAGINVIDMLLGLCSANEPSYSQMLVDKFLYMMPEDQQILREAMRM
FT                   QSFMDDFLQAQQYKDNDWFKYHAKLFIQVCKLHGDTAIGHHNQLVEKFIAQPSKQMQQQ
FT                   HMSKVTASGPPLHVLLDSLEKLRDKRASAKRDDIKTRYDDINLLKQWIK"
     MSTHTAIFDR WIRSAFPQIN SELEQLYWQQ DDKANVEGLG EPLKQQLKDE GNALISNLLA        60
     EGNTDEGFDS AFDLLGNVGL FMAACRRHEI TEPSRETTSP LVEASALAMH IGASIGVTPR       120
     FATAHLTTHN KALNGTYKRF TNLPDEKLFI DYNTQGILAY KRASDALLKI LPLGISHPTC       180
     AELLKVAKQA LIDVIESNNA LYTQLDTERF FNCVRPYYKP HRVGNEIYRG ANAGDFAGIN       240
     VIDMLLGLCS ANEPSYSQML VDKFLYMMPE DQQILREAMR MQSFMDDFLQ AQQYKDNDWF       300
     KYHAKLFIQV CKLHGDTAIG HHNQLVEKFI AQPSKQMQQQ HMSKVTASGP PLHVLLDSLE       360
     KLRDKRASAK RDDIKTRYDD INLLKQWIK                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page