(data stored in ACNUC7421 zone)

EMBL: CR954246.PE501

CR954246.PE501       Location/Qualifiers
FT   CDS             542282..542935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0526"
FT                   /product="putative glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85615"
FT                   /db_xref="GOA:Q3IJ03"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ03"
FT                   /protein_id="CAI85615.1"
FT                   /translation="MSLIVYGVPLSPYVRKVCLCLAAKQLDYKLEIVSPFNQPAWFFEL
FT                   NPLGRIPALKDGDLVLADSSVICQYLDDKYTGNTALLGDTVEQTAQVRWLEKYADYELA
FT                   PLTTFTVFQQRVINLGMQKVCDESLVKLAMNEQLPPHFDYLEGVLGHNDYFVGNALTLA
FT                   DIAFASQIINMQHAGEQINAQRWPNLAALFERVKALPAMQTLLQSEQAMLASMQ"
     MSLIVYGVPL SPYVRKVCLC LAAKQLDYKL EIVSPFNQPA WFFELNPLGR IPALKDGDLV        60
     LADSSVICQY LDDKYTGNTA LLGDTVEQTA QVRWLEKYAD YELAPLTTFT VFQQRVINLG       120
     MQKVCDESLV KLAMNEQLPP HFDYLEGVLG HNDYFVGNAL TLADIAFASQ IINMQHAGEQ       180
     INAQRWPNLA ALFERVKALP AMQTLLQSEQ AMLASMQ                                217
//

If you have problems or comments...

PBIL Back to PBIL home page