(data stored in ACNUC7421 zone)

EMBL: CR954246.PE502

CR954246.PE502       Location/Qualifiers
FT   CDS             542990..543451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0527"
FT                   /product="putative low molecular weight phosphotyrosine
FT                   protein phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85616"
FT                   /db_xref="GOA:Q3IJ02"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ02"
FT                   /protein_id="CAI85616.1"
FT                   /translation="MKKILVVCLGNICRSPTAEAVLKKRAEQLGITVKVDSAGTIGHHE
FT                   GNSPDSRSMQAGEKRGYSFKGIYSRKVRSSDFTEFDLILAADKQNLADLTQRCPAHLQY
FT                   KLALFLEFGEQAVSAIPDPYYGGDDGFEKVLDLIEAASDKILAKLTANV"
     MKKILVVCLG NICRSPTAEA VLKKRAEQLG ITVKVDSAGT IGHHEGNSPD SRSMQAGEKR        60
     GYSFKGIYSR KVRSSDFTEF DLILAADKQN LADLTQRCPA HLQYKLALFL EFGEQAVSAI       120
     PDPYYGGDDG FEKVLDLIEA ASDKILAKLT ANV                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page