(data stored in ACNUC7421 zone)

EMBL: CR954246.PE503

CR954246.PE503       Location/Qualifiers
FT   CDS             complement(543575..544672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0528"
FT                   /product="conserved protein of unknown function ; putative
FT                   TonB domain protein"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85617"
FT                   /db_xref="GOA:Q3IJ01"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ01"
FT                   /protein_id="CAI85617.1"
FT                   /translation="MKPHKLALLLSLNLSVITASAFASEATNANTAFSQAYQNYLSAVD
FT                   TNENIQQAAKLAYSLGAKVYGDNADNTANLAINYAKAISGFNQEDEAKRYELYKQAYNI
FT                   LANNHGESSVETIDALLGMASNTKSARQADSQLERIVDIAKELKKPRFVADMQFAAASL
FT                   LVKKFVPEKYRSAKHYAEEADEYYQANLPENAVERIKSDFLMASFDEGRKKYDSAITRL
FT                   NRIVTVFDNNLSYDHSAELSAHSKLIALYEKQGESEQATKHCLAIAKMVPWEESQEQTP
FT                   LYRVNPDYPMGKARQGKDGSVVMEFEVDTAGFVKNVSVLDSNGGVTFEHSAKKAVEQWR
FT                   YAPKFEDGIPVTAKTQVRLDFKINR"
     MKPHKLALLL SLNLSVITAS AFASEATNAN TAFSQAYQNY LSAVDTNENI QQAAKLAYSL        60
     GAKVYGDNAD NTANLAINYA KAISGFNQED EAKRYELYKQ AYNILANNHG ESSVETIDAL       120
     LGMASNTKSA RQADSQLERI VDIAKELKKP RFVADMQFAA ASLLVKKFVP EKYRSAKHYA       180
     EEADEYYQAN LPENAVERIK SDFLMASFDE GRKKYDSAIT RLNRIVTVFD NNLSYDHSAE       240
     LSAHSKLIAL YEKQGESEQA TKHCLAIAKM VPWEESQEQT PLYRVNPDYP MGKARQGKDG       300
     SVVMEFEVDT AGFVKNVSVL DSNGGVTFEH SAKKAVEQWR YAPKFEDGIP VTAKTQVRLD       360
     FKINR                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page