(data stored in ACNUC7421 zone)

EMBL: CR954246.PE505

CR954246.PE505       Location/Qualifiers
FT   CDS             545564..546352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0530"
FT                   /product="putative membrane protein"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85619"
FT                   /db_xref="GOA:Q3IIZ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIZ9"
FT                   /protein_id="CAI85619.1"
FT                   /translation="MSTQLRVFKADAALKWFKAGWLIFKTQPLTFIFMHLFIGIVGLLS
FT                   LFLPLLQVVAALATPFLTAGFYQAVLTKQQGGKIMLADILKPITTKGNRLGLLRLALYQ
FT                   MGAGILMALLANGLFADAIAVMAQPDLDPNMAISQMLESISMASVVLFLLALSVYLTAF
FT                   AYAVPLVYFNKEQRIFSALKKSFMVFYYNILPLSVYAIICGLFIVLSMFLSFLPLLVLM
FT                   PICYISFFVSYQAIFMPVVPPSDDSNITPLSSESSGRFDA"
     MSTQLRVFKA DAALKWFKAG WLIFKTQPLT FIFMHLFIGI VGLLSLFLPL LQVVAALATP        60
     FLTAGFYQAV LTKQQGGKIM LADILKPITT KGNRLGLLRL ALYQMGAGIL MALLANGLFA       120
     DAIAVMAQPD LDPNMAISQM LESISMASVV LFLLALSVYL TAFAYAVPLV YFNKEQRIFS       180
     ALKKSFMVFY YNILPLSVYA IICGLFIVLS MFLSFLPLLV LMPICYISFF VSYQAIFMPV       240
     VPPSDDSNIT PLSSESSGRF DA                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page