(data stored in ACNUC7421 zone)

EMBL: CR954246.PE51

CR954246.PE51        Location/Qualifiers
FT   CDS             57425..58549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0055"
FT                   /product="putative pyridoxal phosphate dependent enzyme;
FT                   may have an iron-sulfur cluster"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85165"
FT                   /db_xref="GOA:Q3IDE4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE4"
FT                   /protein_id="CAI85165.1"
FT                   /translation="MNQHDFCMAEGCYLLSHSVGRPLKNSQQHLAAHYFSPWESSNKEP
FT                   WQQWLPAVEQFNTALGQLFNAPSEQFCPQVNLSSGLTKLLMSHPRLQQKNCKVLMTQSD
FT                   FPSMGFAMQKALPKCAQITFIPEHENLTDITVWQRYLTDNIDLVFISHVYSNTGVQAPV
FT                   HDIVALSKKTNSLSIIDVAQSAGVIPLDLTALNADFMIGSSVKWLCGGPGAAYLWVNPQ
FT                   QIAVCEPKDVGWFSHQNPFEFDINHFIYNKGALKFWGGTPSVVPYIIAANSIAYFAALG
FT                   IDKVRSHNLAMLALIQQQLGKYVVSPTQQHQCSGTAILNFNMQQQHVLNELNSAGISVD
FT                   ARKLGIRVSPHIYNSADAIHKFIAVIKKAIKVVD"
     MNQHDFCMAE GCYLLSHSVG RPLKNSQQHL AAHYFSPWES SNKEPWQQWL PAVEQFNTAL        60
     GQLFNAPSEQ FCPQVNLSSG LTKLLMSHPR LQQKNCKVLM TQSDFPSMGF AMQKALPKCA       120
     QITFIPEHEN LTDITVWQRY LTDNIDLVFI SHVYSNTGVQ APVHDIVALS KKTNSLSIID       180
     VAQSAGVIPL DLTALNADFM IGSSVKWLCG GPGAAYLWVN PQQIAVCEPK DVGWFSHQNP       240
     FEFDINHFIY NKGALKFWGG TPSVVPYIIA ANSIAYFAAL GIDKVRSHNL AMLALIQQQL       300
     GKYVVSPTQQ HQCSGTAILN FNMQQQHVLN ELNSAGISVD ARKLGIRVSP HIYNSADAIH       360
     KFIAVIKKAI KVVD                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page