(data stored in ACNUC7421 zone)

EMBL: CR954246.PE510

CR954246.PE510       Location/Qualifiers
FT   CDS             complement(550981..551448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0535"
FT                   /product="conserved protein of unknown function ; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85624"
FT                   /db_xref="GOA:Q3ILF0"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILF0"
FT                   /protein_id="CAI85624.1"
FT                   /translation="MTLTTTYTLDKPYFYECFDESVAHSKRAQPKYFLLALLVALGLFG
FT                   IYGLDDHYLGSFLIMVAVLECIAFYYRRPWWVTRQMLSKASGSEVTLTFDEEGIKSSNF
FT                   YKNTQLLWSDINEVITTERGILLKNKKGMQYISKHILTAETLNFIHKKATQ"
     MTLTTTYTLD KPYFYECFDE SVAHSKRAQP KYFLLALLVA LGLFGIYGLD DHYLGSFLIM        60
     VAVLECIAFY YRRPWWVTRQ MLSKASGSEV TLTFDEEGIK SSNFYKNTQL LWSDINEVIT       120
     TERGILLKNK KGMQYISKHI LTAETLNFIH KKATQ                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page