(data stored in ACNUC7421 zone)

EMBL: CR954246.PE516

CR954246.PE516       Location/Qualifiers
FT   CDS             556034..557005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0541"
FT                   /product="putative oxidoreductase, Aldo/keto reductase
FT                   family"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85630"
FT                   /db_xref="GOA:Q3ILE4"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILE4"
FT                   /protein_id="CAI85630.1"
FT                   /translation="MHDTPLAKYLPNVSKLIFGCMGLGGGWNKDPLTNTHTQQAHVCID
FT                   TAIAGGINLFDHADIYTFGKAEQVFGQVLKQRPELREQIYIQSKCGIRFADEQGPKRYD
FT                   LSKQWIEQSVEGSLKRLNTDYLDVLMLHRPDPLIQVEEVAQVFSRLKESGKVRHFAVSN
FT                   MSQQQIQFLQTALDMPIVANQIEASLKQSAWVDEGVYVGNRDGKDINFTPGFIEYCTEQ
FT                   EIQIQSWGSLCQGLYSGKQLQNASPADINTAILVAKLAALYRTSAEAIVLAWLLRHPAL
FT                   IQPVIGTTNAKRLAASCSAVNIELTREHWYALYVSAKGHELP"
     MHDTPLAKYL PNVSKLIFGC MGLGGGWNKD PLTNTHTQQA HVCIDTAIAG GINLFDHADI        60
     YTFGKAEQVF GQVLKQRPEL REQIYIQSKC GIRFADEQGP KRYDLSKQWI EQSVEGSLKR       120
     LNTDYLDVLM LHRPDPLIQV EEVAQVFSRL KESGKVRHFA VSNMSQQQIQ FLQTALDMPI       180
     VANQIEASLK QSAWVDEGVY VGNRDGKDIN FTPGFIEYCT EQEIQIQSWG SLCQGLYSGK       240
     QLQNASPADI NTAILVAKLA ALYRTSAEAI VLAWLLRHPA LIQPVIGTTN AKRLAASCSA       300
     VNIELTREHW YALYVSAKGH ELP                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page