(data stored in ACNUC7421 zone)

EMBL: CR954246.PE518

CR954246.PE518       Location/Qualifiers
FT   CDS             complement(557303..558616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0544"
FT                   /product="putative peptidase, M23/M37 family"
FT                   /EC_number="3.4.24.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85632"
FT                   /db_xref="GOA:Q3ILK0"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILK0"
FT                   /protein_id="CAI85632.1"
FT                   /translation="MVHVVHTLPKKHKLLILGLVSAIAGLAFLPSEKATASKDNSENTL
FT                   EIGKRYELQVKVDDNEKLTALNSEQAADKLPEYDFVDHQVKNGDNLAIIFKRAGFSAQT
FT                   LHKLINTNAETRKLTKIHPGETLSFATAKDGDLAQLRYVISKTDTLFVTLNDEGQYDTS
FT                   IDSKEIETLTKTVGGEISSSFWTSAIAAGLSERQIMNFADIFGWDVDFANDIRKGDGFG
FT                   LIYESHYVDGEFIGTGKIIAAEFVNQGQRYAAIRHTDGSFYTPEGRSMKKAFLRAPVSF
FT                   KYISSSFNPRRLHPVTGQVRAHRGIDFAARTGTPVVASGNGKVIKSGYSKYNGNYVFIS
FT                   HGTQYVTKYLHLNKRLVKTGQKIKQGEQLGTVGSTGRVTGAHLHYEFLVNGVHRNPKTV
FT                   KLPKSEPLPRAELAKFKPIADNFIAQLERNRELQLALK"
     MVHVVHTLPK KHKLLILGLV SAIAGLAFLP SEKATASKDN SENTLEIGKR YELQVKVDDN        60
     EKLTALNSEQ AADKLPEYDF VDHQVKNGDN LAIIFKRAGF SAQTLHKLIN TNAETRKLTK       120
     IHPGETLSFA TAKDGDLAQL RYVISKTDTL FVTLNDEGQY DTSIDSKEIE TLTKTVGGEI       180
     SSSFWTSAIA AGLSERQIMN FADIFGWDVD FANDIRKGDG FGLIYESHYV DGEFIGTGKI       240
     IAAEFVNQGQ RYAAIRHTDG SFYTPEGRSM KKAFLRAPVS FKYISSSFNP RRLHPVTGQV       300
     RAHRGIDFAA RTGTPVVASG NGKVIKSGYS KYNGNYVFIS HGTQYVTKYL HLNKRLVKTG       360
     QKIKQGEQLG TVGSTGRVTG AHLHYEFLVN GVHRNPKTVK LPKSEPLPRA ELAKFKPIAD       420
     NFIAQLERNR ELQLALK                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page