(data stored in ACNUC7421 zone)

EMBL: CR954246.PE52

CR954246.PE52        Location/Qualifiers
FT   CDS             complement(58533..59021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0056"
FT                   /product="putative RNA binding protein"
FT                   /function="5.2 : From other organisms"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85166"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE3"
FT                   /protein_id="CAI85166.1"
FT                   /translation="MIRVILLSICLTAPTFSLAENITVYKCVIKGVPTFSQLPCALDAQ
FT                   AITLKNINVTTAYSDTTASSKITDTSVDDYLKTQQINRDIKRYQLAIKQYQQQYTEKKQ
FT                   QIDYMTQDKANRLGASSIANAIATKTSALKQSYDALIGQAQQQIEALNQQKEQLSQQP"
     MIRVILLSIC LTAPTFSLAE NITVYKCVIK GVPTFSQLPC ALDAQAITLK NINVTTAYSD        60
     TTASSKITDT SVDDYLKTQQ INRDIKRYQL AIKQYQQQYT EKKQQIDYMT QDKANRLGAS       120
     SIANAIATKT SALKQSYDAL IGQAQQQIEA LNQQKEQLSQ QP                          162
//

If you have problems or comments...

PBIL Back to PBIL home page