(data stored in ACNUC7421 zone)

EMBL: CR954246.PE520

CR954246.PE520       Location/Qualifiers
FT   CDS             complement(560414..561358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0546"
FT                   /product="putative cobalamin biosynthesis protein"
FT                   /function="2.5.12 : Heme, porphyrin, and cobalamin"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85634"
FT                   /db_xref="GOA:Q3ILJ8"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILJ8"
FT                   /protein_id="CAI85634.1"
FT                   /translation="MLSNMVQNHLDFIVFIMALLAERFLPLVSWYHPNTALTAIFSAIG
FT                   KRIYKVAEPNSYQYLAATLASTLILSVVLIIIVLLLEFAFYPELLAGLILYLCLESKAI
FT                   DKKALRIAKLTKQNQKSAARELLKPLVARDVTKLSGAGIIKALIESLILRTARYYFVVI
FT                   FVFLVLGPIAALAYRLLTLIEQAWRSNIKPNSPFLKPLKITLFIIEFIPMRLLALTIAA
FT                   SKASKLSMHYIKHYGRHFYQTNTGWLLSTCSASLGVQLGGPAVYFGERFNKMRIGTERL
FT                   PIAEDVPITINRLNQARVFWLLVVVCIEILKNI"
     MLSNMVQNHL DFIVFIMALL AERFLPLVSW YHPNTALTAI FSAIGKRIYK VAEPNSYQYL        60
     AATLASTLIL SVVLIIIVLL LEFAFYPELL AGLILYLCLE SKAIDKKALR IAKLTKQNQK       120
     SAARELLKPL VARDVTKLSG AGIIKALIES LILRTARYYF VVIFVFLVLG PIAALAYRLL       180
     TLIEQAWRSN IKPNSPFLKP LKITLFIIEF IPMRLLALTI AASKASKLSM HYIKHYGRHF       240
     YQTNTGWLLS TCSASLGVQL GGPAVYFGER FNKMRIGTER LPIAEDVPIT INRLNQARVF       300
     WLLVVVCIEI LKNI                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page