(data stored in ACNUC7421 zone)

EMBL: CR954246.PE523

CR954246.PE523       Location/Qualifiers
FT   CDS             complement(562886..563806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0549"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85637"
FT                   /db_xref="GOA:Q3ILJ5"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILJ5"
FT                   /protein_id="CAI85637.1"
FT                   /translation="MQTNMPDIANTAPALQTGTLDWVGMGEIELPFIFESHGITPVTVN
FT                   AKARAFVNLHKEDAKGIHMSRLFLALDTLSTEQQVNPQTLAQALDFFISSHEGLSDKAL
FT                   IEFKFELPLRRKSLLSDKAGWKSYPVILTSTIEQGVINYELSVDVTYSSTCPCSAALAR
FT                   QLIQNAFAEKFSQETLSQKEALEWLGTTQGIVATPHSQRSIANVKVKLDSNITQFDVVN
FT                   LINTIEDELKTPVQAAVKREDEQEFARLNGQNLMFCEDAARKIKALLETQQYSDYWLQI
FT                   NHYESLHAHDALAIAVKGVAGGYRA"
     MQTNMPDIAN TAPALQTGTL DWVGMGEIEL PFIFESHGIT PVTVNAKARA FVNLHKEDAK        60
     GIHMSRLFLA LDTLSTEQQV NPQTLAQALD FFISSHEGLS DKALIEFKFE LPLRRKSLLS       120
     DKAGWKSYPV ILTSTIEQGV INYELSVDVT YSSTCPCSAA LARQLIQNAF AEKFSQETLS       180
     QKEALEWLGT TQGIVATPHS QRSIANVKVK LDSNITQFDV VNLINTIEDE LKTPVQAAVK       240
     REDEQEFARL NGQNLMFCED AARKIKALLE TQQYSDYWLQ INHYESLHAH DALAIAVKGV       300
     AGGYRA                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page