(data stored in ACNUC7421 zone)

EMBL: CR954246.PE529

CR954246.PE529       Location/Qualifiers
FT   CDS             570931..571203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0555"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85643"
FT                   /db_xref="GOA:Q3ILI9"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILI9"
FT                   /protein_id="CAI85643.1"
FT                   /translation="MARTVFCQKLQKEAEGLGFQLYPGEIGEKIFNNISKEAWAQWQHK
FT                   QTMLINEKHLNMMDPEHRSFLEQQMVGFLFENKEVEIEGYKPPEK"
     MARTVFCQKL QKEAEGLGFQ LYPGEIGEKI FNNISKEAWA QWQHKQTMLI NEKHLNMMDP        60
     EHRSFLEQQM VGFLFENKEV EIEGYKPPEK                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page