(data stored in ACNUC7421 zone)

EMBL: CR954246.PE53

CR954246.PE53        Location/Qualifiers
FT   CDS             complement(60483..61412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0058"
FT                   /product="putative integral inner membrane protein;
FT                   putative exporter"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85167"
FT                   /db_xref="GOA:Q3IDE2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE2"
FT                   /protein_id="CAI85167.1"
FT                   /translation="MKSAALYITTVLIWGSTWLAIEFQLGDIAVELSLFYRFAIAALLM
FT                   WLYVAYKKPKMRFNLVDHGFFVLLALFNFGLNYLMLYWAQNHLSSAMTSIAFSMLLVMN
FT                   IVNTRLFFGKPISKRIYTGAVLAILGITCLFWPQLQQLNLSNSAFVGLLLALGGTFVAS
FT                   LGNMVSVRNSRKQIGVLQGNAWGMLYSAIGLALYVFISDVQFNFTAPTSYWLSLLYLSI
FT                   FGTVIAFACYFALLKNIGPEKASYVIVLFPLVAVTLSSFYEGFEWHANTFAGFSLVLLG
FT                   NAIVLTPTKRINAFLANRAVARRGSVPS"
     MKSAALYITT VLIWGSTWLA IEFQLGDIAV ELSLFYRFAI AALLMWLYVA YKKPKMRFNL        60
     VDHGFFVLLA LFNFGLNYLM LYWAQNHLSS AMTSIAFSML LVMNIVNTRL FFGKPISKRI       120
     YTGAVLAILG ITCLFWPQLQ QLNLSNSAFV GLLLALGGTF VASLGNMVSV RNSRKQIGVL       180
     QGNAWGMLYS AIGLALYVFI SDVQFNFTAP TSYWLSLLYL SIFGTVIAFA CYFALLKNIG       240
     PEKASYVIVL FPLVAVTLSS FYEGFEWHAN TFAGFSLVLL GNAIVLTPTK RINAFLANRA       300
     VARRGSVPS                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page