(data stored in ACNUC7421 zone)

EMBL: CR954246.PE530

CR954246.PE530       Location/Qualifiers
FT   CDS             complement(571259..574033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0556"
FT                   /product="putative sensory box histidine kinase/response
FT                   regulator"
FT                   /function="3.2.1.1 : Regulation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85644"
FT                   /db_xref="GOA:Q3ILI5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI5"
FT                   /protein_id="CAI85644.1"
FT                   /translation="MQSKFSSVIKGLLPLFLLSNVIITTLFIIAFSLYSQSEVDTKKSA
FT                   PLIDITSLANKLEAPLIDALTIYGQGKVQELLELTSVFSDNFEYTLYRFSATSQTELVY
FT                   STNKPAIAAIKLNEHLVDQGVLHKVLTLNDQPIGELILKQKKSPPTLTKQTSLLSAYFM
FT                   ACIAVITLFVLALLLNQYINNRLRKSTGLLSEELQAVTDSSNFNSTVNEQLGNGLNVIA
FT                   LNINFLLKKVQAALSENEKTRKELQKLQNNLEIEVQTRTLALEKETLNAQKASEAKTTF
FT                   LATMSHEIRTPMNGVIGTIDLLRQTNLDGSQYRLSTIIRESAFSLLSILDDILDFSKIE
FT                   AGKLNIDPIPFSVTDTIEEVVRVLSSIAKHRDLDLNLSIAPDIPINLIGDNTRVRQILY
FT                   NLCSNAIKFTSTSESHKGQVNISVEVAHNTAEHFTLRFCVTDNGKGMSQAQLREIFNPF
FT                   IQAESSITREYGGTGLGLSICKSLTELMLGTISVNSNIGIGSEFTVELPFSTSGKIKFA
FT                   HKNSLDGRHIVVVSNNVDREKVIYRYLSFMGAKITYVHNEQEIESLHDAKDIIWVVDGI
FT                   DNMDSINAFLRRLLYSLEDNNQQVVVLSKLDDAAINHKNIFYINATPLCKSNFMLSILV
FT                   AAGLHQPKHIKKTIAYDNHLTTEQALAANKLILLVEDNILNQQVITDQLHILGYGVEVA
FT                   NNGEEGINMWRKGNYSLILTDLHMPIMSGYDMVEKIRNEAEMLGSVISQPYIIAVTANS
FT                   LKGEKERCLAVGINDFITKPVELNVLENTLIRWNEKSNHKSIDIPHQKPAMPIDMDSVA
FT                   KYINGDDAKKIRFFKMYLEQSQELIKSINFGVMQSNVNEILEGCHQLKSISKTIGAHRV
FT                   AELAVVFEEQCKTDELNSDKLIDLRDQLEIEYSKAAQFLKEQIKSAEQQEQPS"
     MQSKFSSVIK GLLPLFLLSN VIITTLFIIA FSLYSQSEVD TKKSAPLIDI TSLANKLEAP        60
     LIDALTIYGQ GKVQELLELT SVFSDNFEYT LYRFSATSQT ELVYSTNKPA IAAIKLNEHL       120
     VDQGVLHKVL TLNDQPIGEL ILKQKKSPPT LTKQTSLLSA YFMACIAVIT LFVLALLLNQ       180
     YINNRLRKST GLLSEELQAV TDSSNFNSTV NEQLGNGLNV IALNINFLLK KVQAALSENE       240
     KTRKELQKLQ NNLEIEVQTR TLALEKETLN AQKASEAKTT FLATMSHEIR TPMNGVIGTI       300
     DLLRQTNLDG SQYRLSTIIR ESAFSLLSIL DDILDFSKIE AGKLNIDPIP FSVTDTIEEV       360
     VRVLSSIAKH RDLDLNLSIA PDIPINLIGD NTRVRQILYN LCSNAIKFTS TSESHKGQVN       420
     ISVEVAHNTA EHFTLRFCVT DNGKGMSQAQ LREIFNPFIQ AESSITREYG GTGLGLSICK       480
     SLTELMLGTI SVNSNIGIGS EFTVELPFST SGKIKFAHKN SLDGRHIVVV SNNVDREKVI       540
     YRYLSFMGAK ITYVHNEQEI ESLHDAKDII WVVDGIDNMD SINAFLRRLL YSLEDNNQQV       600
     VVLSKLDDAA INHKNIFYIN ATPLCKSNFM LSILVAAGLH QPKHIKKTIA YDNHLTTEQA       660
     LAANKLILLV EDNILNQQVI TDQLHILGYG VEVANNGEEG INMWRKGNYS LILTDLHMPI       720
     MSGYDMVEKI RNEAEMLGSV ISQPYIIAVT ANSLKGEKER CLAVGINDFI TKPVELNVLE       780
     NTLIRWNEKS NHKSIDIPHQ KPAMPIDMDS VAKYINGDDA KKIRFFKMYL EQSQELIKSI       840
     NFGVMQSNVN EILEGCHQLK SISKTIGAHR VAELAVVFEE QCKTDELNSD KLIDLRDQLE       900
     IEYSKAAQFL KEQIKSAEQQ EQPS                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page