(data stored in ACNUC7421 zone)

EMBL: CR954246.PE531

CR954246.PE531       Location/Qualifiers
FT   CDS             575553..576971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0558"
FT                   /product="putative outer membrane transport protein"
FT                   /function="1.2.8 : Other"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85645"
FT                   /db_xref="GOA:Q3ILI8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI8"
FT                   /protein_id="CAI85645.1"
FT                   /translation="MIWQQYQPTLLALSIVLLSGCASNINSQQREQAPNNVPQQWQQKT
FT                   SAPVLHVQQQWLTQLQNPQLNKLVEQALKNNQQLLQSSYDVAIQKQQLIVSGAALWPTL
FT                   DLSARTSRSKNNRPISYNNASSVSLNLGYEVDLWGKLSDSNRQANLNYLAQQARFEQAK
FT                   QQLVADVVKGWFDIVTAKQLLDLYKHREANALQNLDIIESGYRQGLNEALDVYLARNEL
FT                   NNERSRIATQQASLLTTARVLERLLGDYPKGIISANNDLPVINTDIPLGLPSELITRKP
FT                   TLRANWYQLLASDANLAYAHKQRFPSLNLTASLSDTTDRVSDLFSPSSLAWSLLGSISA
FT                   PIFNGGRLKANEEIARLNSQKQEQQYLQTLYDAFSDVENAITLQQSLKAQYTSTLEAQE
FT                   NALAAEQLSFEQYQSGLVSYTTVLDAQGRSFDAQSSLISIKNQLIANRVNLHLALGGDF
FT                   ANTSTELQSNSNEN"
     MIWQQYQPTL LALSIVLLSG CASNINSQQR EQAPNNVPQQ WQQKTSAPVL HVQQQWLTQL        60
     QNPQLNKLVE QALKNNQQLL QSSYDVAIQK QQLIVSGAAL WPTLDLSART SRSKNNRPIS       120
     YNNASSVSLN LGYEVDLWGK LSDSNRQANL NYLAQQARFE QAKQQLVADV VKGWFDIVTA       180
     KQLLDLYKHR EANALQNLDI IESGYRQGLN EALDVYLARN ELNNERSRIA TQQASLLTTA       240
     RVLERLLGDY PKGIISANND LPVINTDIPL GLPSELITRK PTLRANWYQL LASDANLAYA       300
     HKQRFPSLNL TASLSDTTDR VSDLFSPSSL AWSLLGSISA PIFNGGRLKA NEEIARLNSQ       360
     KQEQQYLQTL YDAFSDVENA ITLQQSLKAQ YTSTLEAQEN ALAAEQLSFE QYQSGLVSYT       420
     TVLDAQGRSF DAQSSLISIK NQLIANRVNL HLALGGDFAN TSTELQSNSN EN               472
//

If you have problems or comments...

PBIL Back to PBIL home page