(data stored in ACNUC7421 zone)

EMBL: CR954246.PE532

CR954246.PE532       Location/Qualifiers
FT   CDS             576961..578262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0559"
FT                   /product="putative Secretion protein"
FT                   /function="1.6 : Protein secretion"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 8407802; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85646"
FT                   /db_xref="GOA:Q3ILI7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI7"
FT                   /protein_id="CAI85646.1"
FT                   /translation="MKTKTAKIIIPIAVIIATILIVMFIKGNPPEANRFGAPPKASINV
FT                   AVQMLQPQNYQVMVDSYGTVKPRTQSLLVAQASGLIINISDDFREGGFFKKGAVLIQLD
FT                   DRDYQAEVKSAQANLLTAKQGLLEEQARGQQAITDWQRLGNDKPASSLVLREPQLAAAQ
FT                   AQVLSAQATLEKAKLNLERTQIIAPFAGRVLSRNVDLGQVVSNNTQLATIYAIDSVEIR
FT                   LPIKNKDLPFINLPEQYRDGAKNQAGSVIKFSSDLVGEQTWQGQLARTEGAIDESAQQL
FT                   YVVAKINDPYKATQSNQYPIKIGQYVKAQITGKTVSDALIIANSTIYQGSYVYIVEQGV
FT                   LKRKDITLAWQNAAFAMIKTGLKAGDKLVITPLGQVSSGTQVNILGEDNKATKPQSMKQ
FT                   RPTAEQLAQQAKEQDISVAELVKKRRAAKQGDKP"
     MKTKTAKIII PIAVIIATIL IVMFIKGNPP EANRFGAPPK ASINVAVQML QPQNYQVMVD        60
     SYGTVKPRTQ SLLVAQASGL IINISDDFRE GGFFKKGAVL IQLDDRDYQA EVKSAQANLL       120
     TAKQGLLEEQ ARGQQAITDW QRLGNDKPAS SLVLREPQLA AAQAQVLSAQ ATLEKAKLNL       180
     ERTQIIAPFA GRVLSRNVDL GQVVSNNTQL ATIYAIDSVE IRLPIKNKDL PFINLPEQYR       240
     DGAKNQAGSV IKFSSDLVGE QTWQGQLART EGAIDESAQQ LYVVAKINDP YKATQSNQYP       300
     IKIGQYVKAQ ITGKTVSDAL IIANSTIYQG SYVYIVEQGV LKRKDITLAW QNAAFAMIKT       360
     GLKAGDKLVI TPLGQVSSGT QVNILGEDNK ATKPQSMKQR PTAEQLAQQA KEQDISVAEL       420
     VKKRRAAKQG DKP                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page