(data stored in ACNUC7421 zone)

EMBL: CR954246.PE533

CR954246.PE533       Location/Qualifiers
FT   CDS             578259..581342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0560"
FT                   /product="putative multidrug resistance
FT                   protein(AcrB/AcrD/AcrF family)"
FT                   /function="4.2 : Detoxification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85647"
FT                   /db_xref="GOA:Q3ILI6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI6"
FT                   /protein_id="CAI85647.1"
FT                   /translation="MIAWFTKNHVAANLLLVTLLLSGLFSLSTKIPIEVFPSFETDMIS
FT                   IQVSLRGATPEDVEQGVTIRIEESVQDLEGIKQIFSRSSEGSGSVTVEVESGYDPRELL
FT                   ADIKSRVDAINTFPGDAEKPIVALAERKREVIAVTVSSDYGEKETREYAEQVRDQILRL
FT                   PSVTQVELSGVRDYELAIEVSQDTLRQYDLTLAQISNAVANSSSDISAGNLKTQGGDVL
FT                   ISSKGQAYRKDEFASIVVKNQSDGTIIRLGDIATINDGFEETPVRTRFNGKQAAFIDVY
FT                   RIGPQSAITVADEVKAYINAQQPSLPQGFALSYWDDDSELVKSRIATLTTNALQGGILV
FT                   LALLTLFLRPAIAFWVFIGIPVSFMGAFIAMPIFGVTLNVMSLFGFILVLGIVVDDAIV
FT                   TGENVYTHLKTAESGEQAAILGTQEVATPVTFGVLTTVAAFLPLAFIEGARGALFAQIP
FT                   VVVIPVLLFSLIESKFVLPAHLKYIKLRHQKGKQSKFDLLQQRFADGFESAILKYYQPI
FT                   LNLALRHKLATVSLFVGVFLIILTMITSGWTKFVFFPRIPSETVRVNLTLPAGTPFEVT
FT                   NKYVIDMSQKAQQLQEKYRDPDTGESVILNILATTGGRGGVSNSGAVRFEITPAEKRDS
FT                   DIGSRELASEWRELIGVIPGAESLTFRAEIGRSSDPIDVQLSGTSLKVLQDVADHIKTR
FT                   LSTYPTVFDIADSMSDGKEELQIELTEQGLALGLNRVNVAGQVRNSFFGSQVQRIQRGR
FT                   DDVRVMVRLPIDERRSVADLQNILINTPAGGSVPLSHVAILITGQSPSTINRIDRYRTL
FT                   NVTADIEKSNTNMTILQADLSQYLDELMQQYPGVDYALEGEAKEQRESFGSLAWALVFV
FT                   FFIIYALLAIPFKSYLQPLIVMSVIPFGMIGAVVGHWIMGMELTIMSLLGMLALIGVVV
FT                   NDSLVLVDYINKKRTEGIELIEVVKLAGASRFRPVMLTSLTTFIGLMPLLFEKATQAQF
FT                   LIPMAVSLGFGIIFATFITLLLVPVNYMLMERFQGWFK"
     MIAWFTKNHV AANLLLVTLL LSGLFSLSTK IPIEVFPSFE TDMISIQVSL RGATPEDVEQ        60
     GVTIRIEESV QDLEGIKQIF SRSSEGSGSV TVEVESGYDP RELLADIKSR VDAINTFPGD       120
     AEKPIVALAE RKREVIAVTV SSDYGEKETR EYAEQVRDQI LRLPSVTQVE LSGVRDYELA       180
     IEVSQDTLRQ YDLTLAQISN AVANSSSDIS AGNLKTQGGD VLISSKGQAY RKDEFASIVV       240
     KNQSDGTIIR LGDIATINDG FEETPVRTRF NGKQAAFIDV YRIGPQSAIT VADEVKAYIN       300
     AQQPSLPQGF ALSYWDDDSE LVKSRIATLT TNALQGGILV LALLTLFLRP AIAFWVFIGI       360
     PVSFMGAFIA MPIFGVTLNV MSLFGFILVL GIVVDDAIVT GENVYTHLKT AESGEQAAIL       420
     GTQEVATPVT FGVLTTVAAF LPLAFIEGAR GALFAQIPVV VIPVLLFSLI ESKFVLPAHL       480
     KYIKLRHQKG KQSKFDLLQQ RFADGFESAI LKYYQPILNL ALRHKLATVS LFVGVFLIIL       540
     TMITSGWTKF VFFPRIPSET VRVNLTLPAG TPFEVTNKYV IDMSQKAQQL QEKYRDPDTG       600
     ESVILNILAT TGGRGGVSNS GAVRFEITPA EKRDSDIGSR ELASEWRELI GVIPGAESLT       660
     FRAEIGRSSD PIDVQLSGTS LKVLQDVADH IKTRLSTYPT VFDIADSMSD GKEELQIELT       720
     EQGLALGLNR VNVAGQVRNS FFGSQVQRIQ RGRDDVRVMV RLPIDERRSV ADLQNILINT       780
     PAGGSVPLSH VAILITGQSP STINRIDRYR TLNVTADIEK SNTNMTILQA DLSQYLDELM       840
     QQYPGVDYAL EGEAKEQRES FGSLAWALVF VFFIIYALLA IPFKSYLQPL IVMSVIPFGM       900
     IGAVVGHWIM GMELTIMSLL GMLALIGVVV NDSLVLVDYI NKKRTEGIEL IEVVKLAGAS       960
     RFRPVMLTSL TTFIGLMPLL FEKATQAQFL IPMAVSLGFG IIFATFITLL LVPVNYMLME      1020
     RFQGWFK                                                                1027
//

If you have problems or comments...

PBIL Back to PBIL home page