(data stored in ACNUC7421 zone)

EMBL: CR954246.PE534

CR954246.PE534       Location/Qualifiers
FT   CDS             581951..582514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0561"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85648"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH3"
FT                   /protein_id="CAI85648.1"
FT                   /translation="MSDLPDYEEAQLLLEKNEIFVSPAEAHGVISGLLACGLTIDDKEY
FT                   LGLLSDVFNDGDSFSNNLKQFFGSIYKQVVASFNDEEFAFDLFLPSDDETLIDQANGLV
FT                   SWVAGFMLGFGLKQKDYGKLSADVKEVITDFSEITRLDTTFEETEEDSQALHEVIEYVR
FT                   VSALLCFAELGKDQSTASTKKTLH"
     MSDLPDYEEA QLLLEKNEIF VSPAEAHGVI SGLLACGLTI DDKEYLGLLS DVFNDGDSFS        60
     NNLKQFFGSI YKQVVASFND EEFAFDLFLP SDDETLIDQA NGLVSWVAGF MLGFGLKQKD       120
     YGKLSADVKE VITDFSEITR LDTTFEETEE DSQALHEVIE YVRVSALLCF AELGKDQSTA       180
     STKKTLH                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page