(data stored in ACNUC7421 zone)

EMBL: CR954246.PE538

CR954246.PE538       Location/Qualifiers
FT   CDS             complement(586328..587338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0565"
FT                   /product="putative transcriptional regulator"
FT                   /function="3.2.1.1 : Regulation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85652"
FT                   /db_xref="GOA:Q3ILI1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI1"
FT                   /protein_id="CAI85652.1"
FT                   /translation="MSTLADHYFSSCIDYLETLGLNSQAVLSAINFNEYSNKQAQQLAP
FT                   RISLNSYNALLNYAQQTLNEPLFGFKLGQQIRTADFGILGYLIESSNNLASAITALLNY
FT                   DSLVADIGRAEFEQQGELVIIRWLPNANCSPQVILRNMTAWVSVIRQLLNPQLSPSTIY
FT                   FTQAFTSNEKTVLTHWFNCPVKTNAQYNQVVFPSSYLALPFKTDNTQINLVLKQVSEQQ
FT                   LSRFKSQQLLTEKISQLFIAKNDLIDCSLIRTAGALNMTPRTLQRHLKREQISFADLLE
FT                   QERKRRVILCIGKEPLSNIAIKLGFNDQSSFNRAFKRWYNCTPLQYLKTLPKNIG"
     MSTLADHYFS SCIDYLETLG LNSQAVLSAI NFNEYSNKQA QQLAPRISLN SYNALLNYAQ        60
     QTLNEPLFGF KLGQQIRTAD FGILGYLIES SNNLASAITA LLNYDSLVAD IGRAEFEQQG       120
     ELVIIRWLPN ANCSPQVILR NMTAWVSVIR QLLNPQLSPS TIYFTQAFTS NEKTVLTHWF       180
     NCPVKTNAQY NQVVFPSSYL ALPFKTDNTQ INLVLKQVSE QQLSRFKSQQ LLTEKISQLF       240
     IAKNDLIDCS LIRTAGALNM TPRTLQRHLK REQISFADLL EQERKRRVIL CIGKEPLSNI       300
     AIKLGFNDQS SFNRAFKRWY NCTPLQYLKT LPKNIG                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page