(data stored in ACNUC7421 zone)

EMBL: CR954246.PE539

CR954246.PE539       Location/Qualifiers
FT   CDS             587399..587878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0566"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85653"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI0"
FT                   /protein_id="CAI85653.1"
FT                   /translation="MVGHYENTYYIKMIQITLKQKIAATPLQVRDALLDHAQLERFFNA
FT                   KFVLLKKQNEGEIIGGKGAIRQVIMAGVRFEERIISADSNHISYQIIGNKPVAEHRGDI
FT                   YFCVSDNTPTSTEVTYNIRCKTPWWLPSLVIKFFIKKDIAQALNKLKANFKGNIS"
     MVGHYENTYY IKMIQITLKQ KIAATPLQVR DALLDHAQLE RFFNAKFVLL KKQNEGEIIG        60
     GKGAIRQVIM AGVRFEERII SADSNHISYQ IIGNKPVAEH RGDIYFCVSD NTPTSTEVTY       120
     NIRCKTPWWL PSLVIKFFIK KDIAQALNKL KANFKGNIS                              159
//

If you have problems or comments...

PBIL Back to PBIL home page