(data stored in ACNUC7421 zone)

EMBL: CR954246.PE54

CR954246.PE54        Location/Qualifiers
FT   CDS             61514..62959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0059"
FT                   /product="putative transcriptional regulator YdcR (GntR
FT                   family)"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85168"
FT                   /db_xref="GOA:Q3IDE1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE1"
FT                   /protein_id="CAI85168.1"
FT                   /translation="MILKAVSHQGHEFLYQQVIQLIRDMSAQQALLPSEKLPSLRKMAS
FT                   NLNISIPTVKQAYQALEDQGVIEAREKSGYFLKAVNMASSLPKRVKLSREPVIVNKQAL
FT                   IEQVYTAIHQAHVVPFGVANPVAAAPTDKALARNMRRVMTLAGSSAINYGPLDGYAPLK
FT                   KQLIHRYLNFGIGINMDEMVITNGAQEALAIALKCVTKPGDVVAIESPCYHGIIELIES
FT                   LGLKALEIPLCPDNGIWLNDLAQALNEHDIKACLFSTAISNPVGSFMPDKNREQLVELV
FT                   ESHNVVLIEDDVYGDLYFTPKRGTPAIAYSKKGLVLSCSSFSKTAAPSYRVGWLIAGKF
FT                   AGQARRYKRALSCSTSLINQWTLSEFVFSGEYDRNLKVLRQRLRTNKEHMRRCLQQAMP
FT                   KGTRISDPQGGCVIWLDLGCEYDSQKLFSLALEVGISITPGLIFSASNKYKSCIRLSYG
FT                   VQWSEQIEQAIVTLGKLTLLAKK"
     MILKAVSHQG HEFLYQQVIQ LIRDMSAQQA LLPSEKLPSL RKMASNLNIS IPTVKQAYQA        60
     LEDQGVIEAR EKSGYFLKAV NMASSLPKRV KLSREPVIVN KQALIEQVYT AIHQAHVVPF       120
     GVANPVAAAP TDKALARNMR RVMTLAGSSA INYGPLDGYA PLKKQLIHRY LNFGIGINMD       180
     EMVITNGAQE ALAIALKCVT KPGDVVAIES PCYHGIIELI ESLGLKALEI PLCPDNGIWL       240
     NDLAQALNEH DIKACLFSTA ISNPVGSFMP DKNREQLVEL VESHNVVLIE DDVYGDLYFT       300
     PKRGTPAIAY SKKGLVLSCS SFSKTAAPSY RVGWLIAGKF AGQARRYKRA LSCSTSLINQ       360
     WTLSEFVFSG EYDRNLKVLR QRLRTNKEHM RRCLQQAMPK GTRISDPQGG CVIWLDLGCE       420
     YDSQKLFSLA LEVGISITPG LIFSASNKYK SCIRLSYGVQ WSEQIEQAIV TLGKLTLLAK       480
     K                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page