(data stored in ACNUC7421 zone)

EMBL: CR954246.PE540

CR954246.PE540       Location/Qualifiers
FT   CDS             587875..588687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0567"
FT                   /product="conserved protein of unknown function ; putative
FT                   sterol desaturase family protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85654"
FT                   /db_xref="GOA:Q3ILH9"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH9"
FT                   /protein_id="CAI85654.1"
FT                   /translation="MSIEIILLALSPVFIIFVSYEFIKYRRYYDIKDSLANTALALMHQ
FT                   GCDAIALIVLMPFFYWLHQYRLFDIELSVLTIFGAFLLQDFLYYWFHKASHHIHWLWAA
FT                   HVVHHSSTKMNFSTAFRQSLMYPLAGMWLFWLPMILIGFDPLSVFTVVALNLAYQFFVH
FT                   TQTVSTLGWFEKVFNTPSHHRVHHAINPGYLDKNFAGVLIIWDKLFGTYAEEKADKPCK
FT                   YGIVGQLNSNNPLTIAFHQWAYLVKSAFKAKGVTAKLKVIFGYPTSSN"
     MSIEIILLAL SPVFIIFVSY EFIKYRRYYD IKDSLANTAL ALMHQGCDAI ALIVLMPFFY        60
     WLHQYRLFDI ELSVLTIFGA FLLQDFLYYW FHKASHHIHW LWAAHVVHHS STKMNFSTAF       120
     RQSLMYPLAG MWLFWLPMIL IGFDPLSVFT VVALNLAYQF FVHTQTVSTL GWFEKVFNTP       180
     SHHRVHHAIN PGYLDKNFAG VLIIWDKLFG TYAEEKADKP CKYGIVGQLN SNNPLTIAFH       240
     QWAYLVKSAF KAKGVTAKLK VIFGYPTSSN                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page