(data stored in ACNUC7421 zone)

EMBL: CR954246.PE541

CR954246.PE541       Location/Qualifiers
FT   CDS             complement(588692..589087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0568"
FT                   /product="conserved protein of unknown function; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85655"
FT                   /db_xref="GOA:Q3ILH8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH8"
FT                   /protein_id="CAI85655.1"
FT                   /translation="MSIEYSILALIGAFLTFYLAKHSRFDGIRASAALSIVTYLIFYWL
FT                   NLDPELYSVVFFGGTFIGMSAPHRFGIYTLASSAVIFSLLFEYLVPILDGYGGALGVSA
FT                   FLSVCICHLFIILGAPRSKNISFRRVK"
     MSIEYSILAL IGAFLTFYLA KHSRFDGIRA SAALSIVTYL IFYWLNLDPE LYSVVFFGGT        60
     FIGMSAPHRF GIYTLASSAV IFSLLFEYLV PILDGYGGAL GVSAFLSVCI CHLFIILGAP       120
     RSKNISFRRV K                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page