(data stored in ACNUC7421 zone)

EMBL: CR954246.PE542

CR954246.PE542       Location/Qualifiers
FT   CDS             complement(589087..589461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0569"
FT                   /product="conserved protein of unknown function; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85656"
FT                   /db_xref="GOA:Q3ILH7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH7"
FT                   /protein_id="CAI85656.1"
FT                   /translation="MRAMIKFLLLKSITFFAGCMSCFVMHTTFALPLVISAALTGLVGS
FT                   FIPFPKLYQNHPYAAIYAGSFAGMCSTSLITSYWEVAIISIIGATLYTLTLNAFAGFGG
FT                   RLGSVAFASVALYSLAKGLV"
     MRAMIKFLLL KSITFFAGCM SCFVMHTTFA LPLVISAALT GLVGSFIPFP KLYQNHPYAA        60
     IYAGSFAGMC STSLITSYWE VAIISIIGAT LYTLTLNAFA GFGGRLGSVA FASVALYSLA       120
     KGLV                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page