(data stored in ACNUC7421 zone)

EMBL: CR954246.PE543

CR954246.PE543       Location/Qualifiers
FT   CDS             589712..590131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0570"
FT                   /product="conserved protein of unknown function ; putative
FT                   glyoxalase domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85657"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH6"
FT                   /protein_id="CAI85657.1"
FT                   /translation="MSNCLHLAIPAGDLNIAKTFYCDVLGCKTGNSEQGRWIDIDFWGN
FT                   ELTLHQSVERLPTVRHDVDMGAVAVPHFGIHLSENEFNALKQRIESAGLEYLDKPYRRF
FT                   IGDEFEQETFFIEDPNGNVLEMKTMVNPEVLFKKS"
     MSNCLHLAIP AGDLNIAKTF YCDVLGCKTG NSEQGRWIDI DFWGNELTLH QSVERLPTVR        60
     HDVDMGAVAV PHFGIHLSEN EFNALKQRIE SAGLEYLDKP YRRFIGDEFE QETFFIEDPN       120
     GNVLEMKTMV NPEVLFKKS                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page