(data stored in ACNUC7421 zone)

EMBL: CR954246.PE544

CR954246.PE544       Location/Qualifiers
FT   CDS             complement(590457..591560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0571"
FT                   /product="putative alginate lyase"
FT                   /function="2.1.3.5 : Biosynthesis and degradation of
FT                   polysaccharides"
FT                   /EC_number="4.2.2.3"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 8200539; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85658"
FT                   /db_xref="GOA:Q3ILH5"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR014895"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH5"
FT                   /protein_id="CAI85658.1"
FT                   /translation="MNKNNITHLIKPGALIALTTSLVIGCVSQQPKSTEQQANPLVPAS
FT                   KFDLSHWKINVPVDLDNDGKIDEIDVKKIQTYSHPDFFYLDDKGYMVFTSPNKALTSAN
FT                   STNTRSEFRQMLRGANTKIKTKSPKNNFALAVHPLSDRFGSIGGKMEATLKVDHVALRA
FT                   TDPSKNAAYSVVVGQIHAGKDQALIDTKLGYGWGNEPLKIYYKKWPGHKTGSVFWNYER
FT                   NLPKTDPNRTDIAYPVWGNTWENPNEPGNAGIALGEEFSYTVNVYKNVMHLTFSTAGKN
FT                   DVSYSINLGNNVDAYGNVDEKDHPHGYAADWHYFKAGAYNQCSTKNAKGIWYPGCLGTG
FT                   DWATDKQNGDYAQVSFSKLVLSPASPQ"
     MNKNNITHLI KPGALIALTT SLVIGCVSQQ PKSTEQQANP LVPASKFDLS HWKINVPVDL        60
     DNDGKIDEID VKKIQTYSHP DFFYLDDKGY MVFTSPNKAL TSANSTNTRS EFRQMLRGAN       120
     TKIKTKSPKN NFALAVHPLS DRFGSIGGKM EATLKVDHVA LRATDPSKNA AYSVVVGQIH       180
     AGKDQALIDT KLGYGWGNEP LKIYYKKWPG HKTGSVFWNY ERNLPKTDPN RTDIAYPVWG       240
     NTWENPNEPG NAGIALGEEF SYTVNVYKNV MHLTFSTAGK NDVSYSINLG NNVDAYGNVD       300
     EKDHPHGYAA DWHYFKAGAY NQCSTKNAKG IWYPGCLGTG DWATDKQNGD YAQVSFSKLV       360
     LSPASPQ                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page