(data stored in ACNUC7421 zone)

EMBL: CR954246.PE545

CR954246.PE545       Location/Qualifiers
FT   CDS             591888..592673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0572"
FT                   /product="conserved protein of unknown function; putative
FT                   inner membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85659"
FT                   /db_xref="GOA:Q3ILH4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH4"
FT                   /protein_id="CAI85659.1"
FT                   /translation="MVAPLLLLFISYAQKKFGSFISGIIPGLPITSGPISYFIAIEQGK
FT                   LFAANSAVGALYGMSGIGLFCFVYMAVSYKCGLAKSLLIALSVWCLFSILTLFLPVNIF
FT                   VACLFSISTLLALTFATTKLKVAIDAKPLNSKWELPIKIVLVTSFIMLVTFISEHIGSA
FT                   WSGLLSTFPVILAVMGSIAYISDKKDSAFKILNGGIIGSLGGCIFFAAIALLLKYDILI
FT                   WQVYTVATISSVLFTLIFSHFINRKYVNPVAFNTAKTQL"
     MVAPLLLLFI SYAQKKFGSF ISGIIPGLPI TSGPISYFIA IEQGKLFAAN SAVGALYGMS        60
     GIGLFCFVYM AVSYKCGLAK SLLIALSVWC LFSILTLFLP VNIFVACLFS ISTLLALTFA       120
     TTKLKVAIDA KPLNSKWELP IKIVLVTSFI MLVTFISEHI GSAWSGLLST FPVILAVMGS       180
     IAYISDKKDS AFKILNGGII GSLGGCIFFA AIALLLKYDI LIWQVYTVAT ISSVLFTLIF       240
     SHFINRKYVN PVAFNTAKTQ L                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page