(data stored in ACNUC7421 zone)

EMBL: CR954246.PE546

CR954246.PE546       Location/Qualifiers
FT   CDS             complement(592682..593683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0573"
FT                   /product="putative AraC-family transcriptional regulatory
FT                   protein"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85660"
FT                   /db_xref="GOA:Q3ILG3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG3"
FT                   /protein_id="CAI85660.1"
FT                   /translation="MSAYYWQNKHKKSPITRKSLPKTIKIVILRKSQPCKDAFMSTIAN
FT                   MLQQYAEQNQLLSFEGTMETIITGVYFHRASKSSPRQPLIYNSGIIVVGQGHKVIHFTD
FT                   HKIQYGAGDYLVLGVPVPLECEAFTDGDLPVLGIAVDINPALLHKLVNQMTEHKQFALP
FT                   PTCGQMSGVQSAKLDNAMELVTKRLLTVLNNPLEAQVFGEDIVKELVYRVLCGPQGHTL
FT                   FGLAMHDGHYARIARTLSIMHSNYANPITVEGLAEDVNMSISSFHRAFKQVTFESPLQY
FT                   LKKLRLAKAKALITASGSKANEAALKVGYTSPSQFSREFKRHFNKTPKEMLL"
     MSAYYWQNKH KKSPITRKSL PKTIKIVILR KSQPCKDAFM STIANMLQQY AEQNQLLSFE        60
     GTMETIITGV YFHRASKSSP RQPLIYNSGI IVVGQGHKVI HFTDHKIQYG AGDYLVLGVP       120
     VPLECEAFTD GDLPVLGIAV DINPALLHKL VNQMTEHKQF ALPPTCGQMS GVQSAKLDNA       180
     MELVTKRLLT VLNNPLEAQV FGEDIVKELV YRVLCGPQGH TLFGLAMHDG HYARIARTLS       240
     IMHSNYANPI TVEGLAEDVN MSISSFHRAF KQVTFESPLQ YLKKLRLAKA KALITASGSK       300
     ANEAALKVGY TSPSQFSREF KRHFNKTPKE MLL                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page