(data stored in ACNUC7421 zone)

EMBL: CR954246.PE547

CR954246.PE547       Location/Qualifiers
FT   CDS             593751..594896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0574"
FT                   /product="putative alcohol dehydrogenase with
FT                   dehydroquinate synthase-like domain"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85661"
FT                   /db_xref="GOA:Q3ILH2"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH2"
FT                   /protein_id="CAI85661.1"
FT                   /translation="MKFSYVNPTLIQFGQQQIASLTDLIAKDQKVLVVYGGGSIKKNGV
FT                   YDQVAAALEGFDWVEFSGVGANPTIEVLDQAVKICKEQDIDFVLGVGGGSVIDGVKYIA
FT                   ASAVYDGEGWDIPTGKHKVTSALPIGAVLTLPATGSESNQGSVVSKAATKQKLPFMSPA
FT                   VQPKFAIMDPDVMKTLPQRQLVNGLVDAWVHTCEQYLTFPEGALVQDGYAEALLKALKV
FT                   LGDNFENQDDAWRANLMWSANQALNGLIGSGVSQDWATHMIGHELTAAYGVDHARSLAI
FT                   VQPSLLRNQFAVKKAKLEQMGKNVFGLAQSDDLAELTIQAIEAFYHSLDVATQLTEHGE
FT                   DKAAAIDNIIGKLEAHGMLALGENQAITLKESREILEQAVA"
     MKFSYVNPTL IQFGQQQIAS LTDLIAKDQK VLVVYGGGSI KKNGVYDQVA AALEGFDWVE        60
     FSGVGANPTI EVLDQAVKIC KEQDIDFVLG VGGGSVIDGV KYIAASAVYD GEGWDIPTGK       120
     HKVTSALPIG AVLTLPATGS ESNQGSVVSK AATKQKLPFM SPAVQPKFAI MDPDVMKTLP       180
     QRQLVNGLVD AWVHTCEQYL TFPEGALVQD GYAEALLKAL KVLGDNFENQ DDAWRANLMW       240
     SANQALNGLI GSGVSQDWAT HMIGHELTAA YGVDHARSLA IVQPSLLRNQ FAVKKAKLEQ       300
     MGKNVFGLAQ SDDLAELTIQ AIEAFYHSLD VATQLTEHGE DKAAAIDNII GKLEAHGMLA       360
     LGENQAITLK ESREILEQAV A                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page