(data stored in ACNUC7421 zone)

EMBL: CR954246.PE548

CR954246.PE548       Location/Qualifiers
FT   CDS             complement(595007..595393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0575"
FT                   /product="putative Zn(II)-responsive transcriptional
FT                   regulator, regulates Zn export (MerR family)"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85662"
FT                   /db_xref="GOA:Q3ILH1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH1"
FT                   /protein_id="CAI85662.1"
FT                   /translation="MQIKQLAHLVNINAKTIRYYEQINLIPAPKRESNGYRTYTQADTE
FT                   RLIFIRRCRDLQIPIDDIKTLLVAQSYGDKSCVEVDDIIENQLIKVRAAQKELKKLEVS
FT                   LASLLTNCTANTINDCQIIKELNS"
     MQIKQLAHLV NINAKTIRYY EQINLIPAPK RESNGYRTYT QADTERLIFI RRCRDLQIPI        60
     DDIKTLLVAQ SYGDKSCVEV DDIIENQLIK VRAAQKELKK LEVSLASLLT NCTANTINDC       120
     QIIKELNS                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page