(data stored in ACNUC7421 zone)

EMBL: CR954246.PE549

CR954246.PE549       Location/Qualifiers
FT   CDS             595491..595811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0576"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85663"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH0"
FT                   /protein_id="CAI85663.1"
FT                   /translation="MHSKRFLIVILLVLVHSFISCDGAAYHLQEDVDHITSAQLQSNIT
FT                   ADGSQNEAQASAEIHAHQHCHSGYYSTVNHSISPEQSNPALPVRYCGLIYPPMSRPPIS
FT                   LS"
     MHSKRFLIVI LLVLVHSFIS CDGAAYHLQE DVDHITSAQL QSNITADGSQ NEAQASAEIH        60
     AHQHCHSGYY STVNHSISPE QSNPALPVRY CGLIYPPMSR PPISLS                      106
//

If you have problems or comments...

PBIL Back to PBIL home page