(data stored in ACNUC7421 zone)

EMBL: CR954246.PE55

CR954246.PE55        Location/Qualifiers
FT   CDS             complement(63081..63875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0060"
FT                   /product="putative secreted protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85169"
FT                   /db_xref="InterPro:IPR021307"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE0"
FT                   /protein_id="CAI85169.1"
FT                   /translation="MKKLLLMSTLICAPAVVAHNDNDSTVSFNNEQCNVEFKNDVRIKP
FT                   DELEIFTANKQTMQFNTNGNLTINGESVALNHSQQKALTQYSDSLRTQLPEVANIALEG
FT                   VKIAGVALQEVANAFNIDGLDNISSLMDDIKLEVQNTFYQQDTFVMDQQSFNQFGENFE
FT                   QQFEQQIETAVESAVMQSMGSILVALGSELLGSGGDMQAFEQRMENMGTQIEEKVEQHA
FT                   DALEKRANALCENFANIAKQEEQLVVQVPELKGYQLFSFKQN"
     MKKLLLMSTL ICAPAVVAHN DNDSTVSFNN EQCNVEFKND VRIKPDELEI FTANKQTMQF        60
     NTNGNLTING ESVALNHSQQ KALTQYSDSL RTQLPEVANI ALEGVKIAGV ALQEVANAFN       120
     IDGLDNISSL MDDIKLEVQN TFYQQDTFVM DQQSFNQFGE NFEQQFEQQI ETAVESAVMQ       180
     SMGSILVALG SELLGSGGDM QAFEQRMENM GTQIEEKVEQ HADALEKRAN ALCENFANIA       240
     KQEEQLVVQV PELKGYQLFS FKQN                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page