(data stored in ACNUC7421 zone)

EMBL: CR954246.PE550

CR954246.PE550       Location/Qualifiers
FT   CDS             595995..597242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0577"
FT                   /product="putative metal ion efflux outer membrane factor
FT                   protein family"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85664"
FT                   /db_xref="GOA:Q3ILG9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG9"
FT                   /protein_id="CAI85664.1"
FT                   /translation="MLVALLCVLPVFNALANVSASENILTLKQALSNTEQQNPILKRYP
FT                   YHQKILSALKSQATLSPNPVLSVAVENVLGTNDARGVKGAEITLGLSQLIELGDKRQSR
FT                   VGFATANIKAQAIQYQNTRLALLATTAERYYSALKFQTLLALNVERKSVVTQALKTIEQ
FT                   RANAGAVSQADVSRMRYALSQVELEQVKLTSEFERARLLLNELWIDEQSSAFLAGNINV
FT                   ITPLKSQQALLDAVNLAPEFALLQQQYIQQTANLALQKANGQSDINVGGGVRYNQKNDS
FT                   SSLLFSFSMPLQISNANSGNIAAAASELALLNQQQGQLRVQLRQQVRTLYAYYQGIANQ
FT                   ATLLNKQIIPQTQTLIEQSLNSYQRGQISVLQLLDAQQAHFDSKRALIATHAELYQVLL
FT                   TLERLTGQSLIETYQS"
     MLVALLCVLP VFNALANVSA SENILTLKQA LSNTEQQNPI LKRYPYHQKI LSALKSQATL        60
     SPNPVLSVAV ENVLGTNDAR GVKGAEITLG LSQLIELGDK RQSRVGFATA NIKAQAIQYQ       120
     NTRLALLATT AERYYSALKF QTLLALNVER KSVVTQALKT IEQRANAGAV SQADVSRMRY       180
     ALSQVELEQV KLTSEFERAR LLLNELWIDE QSSAFLAGNI NVITPLKSQQ ALLDAVNLAP       240
     EFALLQQQYI QQTANLALQK ANGQSDINVG GGVRYNQKND SSSLLFSFSM PLQISNANSG       300
     NIAAAASELA LLNQQQGQLR VQLRQQVRTL YAYYQGIANQ ATLLNKQIIP QTQTLIEQSL       360
     NSYQRGQISV LQLLDAQQAH FDSKRALIAT HAELYQVLLT LERLTGQSLI ETYQS            415
//

If you have problems or comments...

PBIL Back to PBIL home page