(data stored in ACNUC7421 zone)

EMBL: CR954246.PE553

CR954246.PE553       Location/Qualifiers
FT   CDS             complement(601715..602965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0580"
FT                   /product="putative orphan protein ; putative membrane
FT                   protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85667"
FT                   /db_xref="GOA:Q3ILG6"
FT                   /db_xref="InterPro:IPR022227"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG6"
FT                   /protein_id="CAI85667.1"
FT                   /translation="MQSARFIPFRKQDIVDMCSEELNNNTQQTSFKQFCDLLASLIHYD
FT                   YHTVLESLKNNYAPFDPNSDTRSLAPVSADQKAQCQHEFAKDFAKVLNAANFEVITNED
FT                   LQDALNEESLFKVRLEVEFDDFEEVVFYRRGESQLTETITSFWGLRKKPLHFTNYDRVA
FT                   VFIRFKDSAYFKAKNKTPLGFEPSSTIVKLFQNVPKADLEMLFPNSEVRMRPIDKVIIG
FT                   SSALVGGAVVLITKLGASIVLLLALFAFWGGFRSEAVEMTQQHFITFAIGMGVFGSFIF
FT                   KEWSKFKNRKIKFMKALSDNLYFKNLDNNAGVFHTLIDAAEEEDIKEALLAYTFLLKSE
FT                   SGLSAQMLDEQIEHWFKSKYQCVLDFEISDALEKLVRMRLVTCSNEIEGNEVYSALSLE
FT                   HAKTILDKRWDNLFQYN"
     MQSARFIPFR KQDIVDMCSE ELNNNTQQTS FKQFCDLLAS LIHYDYHTVL ESLKNNYAPF        60
     DPNSDTRSLA PVSADQKAQC QHEFAKDFAK VLNAANFEVI TNEDLQDALN EESLFKVRLE       120
     VEFDDFEEVV FYRRGESQLT ETITSFWGLR KKPLHFTNYD RVAVFIRFKD SAYFKAKNKT       180
     PLGFEPSSTI VKLFQNVPKA DLEMLFPNSE VRMRPIDKVI IGSSALVGGA VVLITKLGAS       240
     IVLLLALFAF WGGFRSEAVE MTQQHFITFA IGMGVFGSFI FKEWSKFKNR KIKFMKALSD       300
     NLYFKNLDNN AGVFHTLIDA AEEEDIKEAL LAYTFLLKSE SGLSAQMLDE QIEHWFKSKY       360
     QCVLDFEISD ALEKLVRMRL VTCSNEIEGN EVYSALSLEH AKTILDKRWD NLFQYN           416
//

If you have problems or comments...

PBIL Back to PBIL home page