(data stored in ACNUC7421 zone)

EMBL: CR954246.PE554

CR954246.PE554       Location/Qualifiers
FT   CDS             complement(603129..603524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0581"
FT                   /product="putative transposase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85668"
FT                   /db_xref="GOA:Q3ILG5"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG5"
FT                   /protein_id="CAI85668.1"
FT                   /translation="MEYETKSHCKYLIALHLILVVKYRKQLLKGDVGDFVKQKITEIAE
FT                   RSEFNIEEIEVDKDHIHILLTISPNISVASYVRRIKQSTTQSLWSRFKWFKKQFWVKKT
FT                   FWSDGYFVCSVGNAAADTIRKYIQEQG"
     MEYETKSHCK YLIALHLILV VKYRKQLLKG DVGDFVKQKI TEIAERSEFN IEEIEVDKDH        60
     IHILLTISPN ISVASYVRRI KQSTTQSLWS RFKWFKKQFW VKKTFWSDGY FVCSVGNAAA       120
     DTIRKYIQEQ G                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page