(data stored in ACNUC7421 zone)

EMBL: CR954246.PE555

CR954246.PE555       Location/Qualifiers
FT   CDS             603563..604789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0582"
FT                   /product="putative transposase (IS605)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85669"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG4"
FT                   /protein_id="CAI85669.1"
FT                   /translation="MKKTLRYNYRLNPTPEQEAKLVEFGATARGIWNLLLSENMRRYEH
FT                   DKTFLFYKDMASLLKDIKTFEEFNWIKAFDSAAAQQVARDLELALKNAFTKGRLQRFPK
FT                   HKISYKKKKLHNDSFRAVNNSNCIRIENGAISIPKVGKIPIILHRKLASKIKTVTIQYH
FT                   HGKWGCSITQEVECKTAKQVLKTITGFDINSKQTVVGSDGFVVDNPKFLKQSKTKLNQL
FT                   QRQLARRTKGSNRWQKTKQRINKLHGKISRQRLDFAHKISRQITNENDILVFEDLNVKG
FT                   MQKFNGSMVADNVMGLITQLSKYKTELEGKLYHEIGRFEKSTGVCSECGQHHVLTLNDR
FT                   YFTCTACETYQSRDLSAAKSIAKTGELDLIAAGIVARVTPTSQQKSAIKTKVFELSKFA
FT                   VGTEKKEAA"
     MKKTLRYNYR LNPTPEQEAK LVEFGATARG IWNLLLSENM RRYEHDKTFL FYKDMASLLK        60
     DIKTFEEFNW IKAFDSAAAQ QVARDLELAL KNAFTKGRLQ RFPKHKISYK KKKLHNDSFR       120
     AVNNSNCIRI ENGAISIPKV GKIPIILHRK LASKIKTVTI QYHHGKWGCS ITQEVECKTA       180
     KQVLKTITGF DINSKQTVVG SDGFVVDNPK FLKQSKTKLN QLQRQLARRT KGSNRWQKTK       240
     QRINKLHGKI SRQRLDFAHK ISRQITNEND ILVFEDLNVK GMQKFNGSMV ADNVMGLITQ       300
     LSKYKTELEG KLYHEIGRFE KSTGVCSECG QHHVLTLNDR YFTCTACETY QSRDLSAAKS       360
     IAKTGELDLI AAGIVARVTP TSQQKSAIKT KVFELSKFAV GTEKKEAA                    408
//

If you have problems or comments...

PBIL Back to PBIL home page