(data stored in ACNUC7421 zone)

EMBL: CR954246.PE556

CR954246.PE556       Location/Qualifiers
FT   CDS             604947..605531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0583"
FT                   /product="conserved protein of unknown function; putative
FT                   inner membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85670"
FT                   /db_xref="GOA:Q3ILG2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG2"
FT                   /protein_id="CAI85670.1"
FT                   /translation="MAIQKKLKQKTRNFIESKHMLSGITVASFLESTIVPIPLEAVLVP
FT                   LMQARREKLWLIALMATLGCIVGALFGYALGYYLFDAVGDWVINSFSSPEQFENVKQQM
FT                   HNQGFWFVITLGIVPIPFQIAMLAAGATKYSLGLFLLASAISRAIRYFALAVVVYYAGN
FT                   KAEQLISKHKTKAMITLTVFVIGIWWLTTVI"
     MAIQKKLKQK TRNFIESKHM LSGITVASFL ESTIVPIPLE AVLVPLMQAR REKLWLIALM        60
     ATLGCIVGAL FGYALGYYLF DAVGDWVINS FSSPEQFENV KQQMHNQGFW FVITLGIVPI       120
     PFQIAMLAAG ATKYSLGLFL LASAISRAIR YFALAVVVYY AGNKAEQLIS KHKTKAMITL       180
     TVFVIGIWWL TTVI                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page