(data stored in ACNUC7421 zone)

EMBL: CR954246.PE557

CR954246.PE557       Location/Qualifiers
FT   CDS             605572..608217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0584"
FT                   /product="conserved protein of unknown function; putative
FT                   integral membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85671"
FT                   /db_xref="GOA:Q3ILG1"
FT                   /db_xref="InterPro:IPR014600"
FT                   /db_xref="InterPro:IPR019286"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG1"
FT                   /protein_id="CAI85671.1"
FT                   /translation="MDELIGLVGLFILAIIAGAICGFIALTQLKSLRQQVVQLTAKVNS
FT                   LLQQQEQLVPLASKQAPPQAQPQPQVSTPATVSTQVKTAAISGNEAVVTKTAKTNTFPK
FT                   KPSVLNTLFNKLRAGLEENWMTWIGAIALAFGGIFLAKYSLEAGLLSPVMRLSLGALFG
FT                   LGLIAAAGYLHYKRIIFEGFNNYIPAALASGGFITCFALALLAYSNYAMLSSTVAFVLL
FT                   AIIALSASVMAIKFGPLLAVLGIVGAYSVPIWVSSNSVNLFSLFMYVGFVSLFAAIVAH
FT                   QVQRIWLWYLLWAGHVFWYLAGFVLLESSTIWLLGVYAVASIIGLVAIPRLGVRFTLIE
FT                   FRPHSLKRLINVLPDHPLMLVFTAPFILMMLLHRFDAQFQIFSLITLVLMLFLVLKNSR
FT                   WDLWQAVCLVIAFIVLVSTQQTFDFDDALFIFKQEYGLGLILGFTLTAYGLYFGRKFPK
FT                   RLAFHITGAFSLFLMIATLYALIPNSALSTAYPLWAVILLVGSAVLIKSAQHSASLYQR
FT                   FTYWIAANANITLAITMLLNDSGLTIALAIQVLLISLLIKRHSIPMPHWPIKALVAALL
FT                   LRLTFSPWTPSYEALTIFGLHWSIVVYPLCTVLFYVAARCFNTSKMQLWLEGAALHCLA
FT                   LFITTETSYQLVGHYPQFDSLSFYEQVLLVCNWLGLGCVYLYRARIVGSLAKLYRIGGF
FT                   ALAGLAGVFALKTLVDDNPLLSAIDIGTTPIFNWLLLLWLVPAGLTLWLARLLKTINSK
FT                   AINTKVIAIVLAIAGIFTFLAINSLIRQYWQGAYIYLSKGVGNAELYSYSIIWLVLGAS
FT                   TVIVGHLKNQLLIQKVGLGLLAAVILKVFLIDMANLTGLLKAISFIGLGLSLVGLSWLF
FT                   QKLRSRANLA"
     MDELIGLVGL FILAIIAGAI CGFIALTQLK SLRQQVVQLT AKVNSLLQQQ EQLVPLASKQ        60
     APPQAQPQPQ VSTPATVSTQ VKTAAISGNE AVVTKTAKTN TFPKKPSVLN TLFNKLRAGL       120
     EENWMTWIGA IALAFGGIFL AKYSLEAGLL SPVMRLSLGA LFGLGLIAAA GYLHYKRIIF       180
     EGFNNYIPAA LASGGFITCF ALALLAYSNY AMLSSTVAFV LLAIIALSAS VMAIKFGPLL       240
     AVLGIVGAYS VPIWVSSNSV NLFSLFMYVG FVSLFAAIVA HQVQRIWLWY LLWAGHVFWY       300
     LAGFVLLESS TIWLLGVYAV ASIIGLVAIP RLGVRFTLIE FRPHSLKRLI NVLPDHPLML       360
     VFTAPFILMM LLHRFDAQFQ IFSLITLVLM LFLVLKNSRW DLWQAVCLVI AFIVLVSTQQ       420
     TFDFDDALFI FKQEYGLGLI LGFTLTAYGL YFGRKFPKRL AFHITGAFSL FLMIATLYAL       480
     IPNSALSTAY PLWAVILLVG SAVLIKSAQH SASLYQRFTY WIAANANITL AITMLLNDSG       540
     LTIALAIQVL LISLLIKRHS IPMPHWPIKA LVAALLLRLT FSPWTPSYEA LTIFGLHWSI       600
     VVYPLCTVLF YVAARCFNTS KMQLWLEGAA LHCLALFITT ETSYQLVGHY PQFDSLSFYE       660
     QVLLVCNWLG LGCVYLYRAR IVGSLAKLYR IGGFALAGLA GVFALKTLVD DNPLLSAIDI       720
     GTTPIFNWLL LLWLVPAGLT LWLARLLKTI NSKAINTKVI AIVLAIAGIF TFLAINSLIR       780
     QYWQGAYIYL SKGVGNAELY SYSIIWLVLG ASTVIVGHLK NQLLIQKVGL GLLAAVILKV       840
     FLIDMANLTG LLKAISFIGL GLSLVGLSWL FQKLRSRANL A                           881
//

If you have problems or comments...

PBIL Back to PBIL home page