(data stored in ACNUC7421 zone)

EMBL: CR954246.PE56

CR954246.PE56        Location/Qualifiers
FT   CDS             64159..64449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0061"
FT                   /product="doubtful membrane bound protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85170"
FT                   /db_xref="GOA:Q3IDD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDD9"
FT                   /protein_id="CAI85170.1"
FT                   /translation="MALNCIALYVSNILILPIIAIIKSLVGLKHFMEWVVGKTFSYDAL
FT                   DDDFVEDEYEMLGRNQHDKNKQKVKKKLEDYLEQKRLRKNLGEDDLSDYTD"
     MALNCIALYV SNILILPIIA IIKSLVGLKH FMEWVVGKTF SYDALDDDFV EDEYEMLGRN        60
     QHDKNKQKVK KKLEDYLEQK RLRKNLGEDD LSDYTD                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page